Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSYSSQSTAIPPSPTSPPQSGLKRRRLSDHLPQSPISPSYMSVATKSYVSPYGNAQHTDEVTGHSSPRSPRGAPPRSQQSSSRMTPSLPTPAHSVTGNSGLDMADEADQHRDKRPRFDDTRNDEGDEMEVEPLTRAANHDRLDVMDTDDAKAGSAYTGQHERGGTSVHETTLEQIQKDMGEAFLLCRSKVEPQRPNPQQHLLALYGLSPLLRSVARNDPKTGEKINKLRKSYEGQIKSFGLAGRNKPVKGERNADEDQPGPIRRMVGSLPWGLQPDEQWSEEHGGSKIEVTPDLKARLKEAMHMQPGTVRNNAHWEDVLGFDKKPNVVPAQPLINPPAVPRVPNGIPRQPGQPSAEAKRQTRGKKRSYGDDSFVGYGEGYSDPEDGGDTDEYGGQRKRKKDLVGTPVTYGQYQGR |
Length | 415 |
Position | Head |
Organism | Exophiala sideris |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.097 |
Instability index | 57.67 |
Isoelectric point | 8.39 |
Molecular weight | 45677.98 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02565 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.11| 13| 16| 325| 338| 1 --------------------------------------------------------------------------- 325- 338 (22.58/14.34) PNVVPAQPlINPPA 343- 355 (27.53/13.61) PNGIPRQP.GQPSA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 5| 122.34| 16| 16| 67| 82| 2 --------------------------------------------------------------------------- 11- 25 (25.13/10.36) PPSP.TSPPQSGLKRR 32- 47 (24.59/ 9.99) PQSPISPSYMSVATKS 48- 63 (22.34/ 8.39) YVSPYGNAQHTDEVTG 67- 82 (27.48/12.03) PRSPRGAPPRSQQSSS 86- 99 (22.80/ 8.71) PSLP..TPAHSVTGNS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.46| 21| 24| 100| 122| 3 --------------------------------------------------------------------------- 100- 120 (38.36/29.32) GLDMADEADQHRDKRPRFD..DT 125- 147 (32.11/16.29) GDEMEVEPLTRAANHDRLDvmDT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 64.23| 22| 25| 184| 206| 4 --------------------------------------------------------------------------- 184- 206 (35.30/22.77) LLcRS..KVEPQRPNPQQHLLALY.G 210- 234 (28.94/13.30) LL.RSvaRNDPKTGEKINKLRKSYeG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.05| 15| 16| 384| 398| 6 --------------------------------------------------------------------------- 384- 398 (26.56/14.04) EDGGDTDEYGGQRKR 401- 415 (25.49/13.19) DLVGTPVTYGQYQGR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QSGLKRRRLSDHLPQSPISPSYMSVATKSYV 2) VGYGEGYS 3) YGGQRKRKKDLVGTPVTYGQYQG | 19 374 392 | 49 381 414 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab