<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02528
| Description |
Mediator of RNA polymerase II transcription subunit 4 (Fragment) |
| Sequence | HSPSPCRLILAPPVQAGAACNEPSTSCLVLSTLGAYSELTKHLFSIIENPSLSSKTIVDASAGKMWNVNDITGLLSALQEVDQLFNSRLEIAHQHAINQRRIEALQEQAKRRDRETRQAILELSRIQSELAEMARLSEEEVASIEKAEKQPIGHSTLLGYAQRLARYTSAPPGYKLPRVASAAATQKDDVAGVKSEQRADGEPVEQISLGADYNQYAKRAAAYYDPAIPSMPQEMPFPSDAMMRQGILNSQQMLDGAAPAEQPADETMDDSEELPLTDFAASYSHLRQQQQRHDEEDEDAFDLDLN |
| Length | 306 |
| Position | Middle |
| Organism | Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Ustilago.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.549 |
| Instability index | 69.36 |
| Isoelectric point | 4.75 |
| Molecular weight | 33717.17 |
| Publications | PubMed=17080091
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP02528
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.70| 32| 36| 220| 252| 1
---------------------------------------------------------------------------
220- 252 (55.33/33.73) AAAYYDPAIPSM..PQEMPFpSDAMMRQGILNSQQ
257- 290 (51.37/26.68) AAPAEQPADETMddSEELPL.TDFAASYSHLRQQQ
---------------------------------------------------------------------------
|