<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02526
| Description |
Uncharacterized protein |
| Sequence | MDLLTQLDNDIDLLLKIMSSSIAYISRKAKHAPLPDSTIPLTVLGKTEAVSAVELDASISELVADLVDKADSIREIIEHLPTEASLGGDTELQHQLMAMQSELQTVNKSYMQLSTQVDSLSAEVRELLGLLTQSHSDARRWLVDQLDAQCTPAPISISATDA |
| Length | 162 |
| Position | Middle |
| Organism | Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Ustilaginomycetes> Ustilaginales> Ustilaginaceae> Ustilago.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.017 |
| Instability index | 49.34 |
| Isoelectric point | 4.40 |
| Molecular weight | 17595.77 |
| Publications | PubMed=17080091
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02526
No repeats found
|