<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02524

Description "Unplaced genomic scaffold scaffold_1039, whole genome shotgun sequence"
SequenceMATDFWASSHYKRWIVDRVTLREARADDLQYVDDPEYFTYFSVFFANVITKLGKKLGFRQRVIATAIVFFRRFYLKNLYCETEPFIVIAACCYLAGKAEESPMHIKNVVAEARLFFSQQPYGVKSFPSDNSKLAEMEFYLVADLECDLTIFHPYRTLMALCEKESSGDLMTEAGEVGVCTDDGPRYWGTGEGQLELPDEALQLAWSIINDTYRSDLCLLYPPHLLAITALYLTLVLHGPTGDLIQQKSLPASSDSNSPRRSSRQASTSSLGSKRTPQDYIGFFAGLNVSMPLIATIAQEMIALYSIWERYREDVDSTTTQPLAGSPYSATTQGSSKRTLSDSRSGSHSRVGTPVEGMDEPRKAEEAGVITPALLLRVLTRMRETRLSDLVAHSGTGRPVAINKMLERTQAAG
Length412
PositionKinase
OrganismPaxillus rubicundulus Ve08.2h10
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Boletales> Paxilineae> Paxillaceae> Paxillus.
Aromaticity0.10
Grand average of hydropathy-0.202
Instability index46.75
Isoelectric point5.76
Molecular weight45963.73
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP02524
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      59.26|      13|      67|      73|      85|       1
---------------------------------------------------------------------------
   73-   85 (25.17/17.04)	FYL.KNLYCETEPF
  103-  115 (17.96/10.34)	MHI.KNVVAEARLF
  138-  151 (16.13/ 8.63)	FYLvADLECDLTIF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.76|      15|      16|     339|     353|       2
---------------------------------------------------------------------------
  339-  353 (25.82/14.77)	LSDSRSGSHSRVGTP
  357-  371 (25.94/14.86)	MDEPRKAEEAGVITP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP02524 with CycC domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) TTTQPLAGSPYSATTQGSSKRTLSDSRSGSHSRVGTPVEGMDEPRKA
317
363

Molecular Recognition Features

MoRF SequenceStartStop
NANANA