<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02517
Description |
"Unplaced genomic scaffold scaffold_10, whole genome shotgun sequence (Fragment)" |
Sequence | LRFTIAEVLTAYVSLVFAREEDPLVIEKVTAFGPRERKFPHEQSDYQVYQVLSQHLAKMLQSHPHVPLQTLMQALVSYRTLFVDRCTSCQRVLSVEGHIPPVGRI |
Length | 105 |
Position | Tail |
Organism | Pisolithus microcarpus 441 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Boletales> Sclerodermatineae> Pisolithaceae> Pisolithus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.022 |
Instability index | 48.90 |
Isoelectric point | 8.04 |
Molecular weight | 12061.86 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02517
No repeats found
No repeats found
|