<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02508

Description "Unplaced genomic scaffold K443scaffold_77, whole genome shotgun sequence"
SequenceMSGSELWLSRSLLLNFLDCCLPWRHAAGVNLFLNFRVGSGSSLFYLLPPIMHALTDFREKVITKLGKKLQLRQKVIATATVFFRRFYLKNSYCETDPFIVIAACCYVAAKAEESPIHIKNVMTESRTLFSQEIYNIKHFPTDNSKLAEMEFYLVDDLECDLIVFHPYRTLLTLCRKEEDEGSAVSEDGEAGEVGTGVDDGPRYWGSGEGQLELAPEALQTAWSIINDTYRSELCLVHPPHLIAIAAIYLTFILHPPTRPELSSTSEPDADLSPEQTAPQPRRSSRQAHNAISAGQTPPKKPQDPITFLSQLNVSLPLIATIAQEIISLYTLWDRYKEDATPDAPKLSRDVSQSPMASSTATSPTKRLAPSSSRSGSASMRGGSHSVSGAGTPDGIDVGVGDETYITPSFLSATLLSMREARLADLAHAGRSVAVNKVLERMQAAG
Length445
PositionKinase
OrganismLaccaria amethystina LaAM-08-1
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Tricholomataceae> Laccaria.
Aromaticity0.08
Grand average of hydropathy-0.171
Instability index52.88
Isoelectric point5.72
Molecular weight48835.94
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP02508
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     111.00|      26|      82|     256|     281|       1
---------------------------------------------------------------------------
  256-  281 (46.55/26.04)	PTRPELSSTSEPDADLSPEQTAP.QPR
  283-  302 (22.16/ 8.81)	......SSRQAHNA.ISAGQTPPkKPQ
  341-  366 (42.30/23.04)	PDAPKLSRDVSQSPMASSTATSP.TKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     143.97|      44|     199|     173|     218|       5
---------------------------------------------------------------------------
  173-  218 (67.07/42.86)	LCRKEEDEGSAVSEDGEAGEVGTGVDDGPRYwGSGEgQLELAPEAL
  367-  410 (76.90/39.90)	LAPSSSRSGSASMRGGSHSVSGAGTPDGIDV.GVGD.ETYITPSFL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP02508 with CycC domain of Kingdom Fungi

Unable to open file!