<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02500
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MGFTGLARWVNAPTTSLQQVQENITLNHNGLYKGKWHLSVRSYRSTLGKVPGFHVPSERTMCALTMNENVFVLLEDPMAPTRGDVLAAAPPGQEAAYIQGPAHYRTAFLTIRPPGALEQLLTQLKARWAAVRQSSSGPQRGQTTGQQLFIEGHIFAIGTDWLVRVGNVVLAGGAVKGMLLEAEYLPLPLLHSPITDGTSELLSNLLTSLLPNVSGATTVAVTISESQWEEVLWDREEEAMGRTNVTDSEPNPEDVVYAYGDEDILEQKQDWVGVNRDRRSAYLIMGALRSEGIM |
| Length | 294 |
| Position | Head |
| Organism | Laccaria amethystina LaAM-08-1 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Tricholomataceae> Laccaria.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.187 |
| Instability index | 54.04 |
| Isoelectric point | 5.21 |
| Molecular weight | 32253.20 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02500
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.93| 18| 21| 74| 92| 1
---------------------------------------------------------------------------
74- 92 (28.87/21.03) LEDPmAPTRGDVLAAAPPG
98- 115 (35.07/20.67) IQGP.AHYRTAFLTIRPPG
---------------------------------------------------------------------------
|