<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02486

Description Cyclin-C-like
SequenceMAANYWASTQRNHWMIDRWTLAKSKEEDLKYVSEADYVKLRIWFCHLIQKLAKRLQLRQQVVATAFVYFKRFYLNNSIKATDPILVLVTCVYLATKIEECPIHIKMVTQEAKTVFQAEFGGFPYDSSKVAEFEFYLLEELEFYLIIWHPYRSLTQICNELGMRESGLQYAWFIVNDSYRTDVSLLYPPHLISLAAIYITVVLNHADFTPGSAGDQRDMKQWFADLNVDIKSVIEISQEILAIYEVWADWKEEKMLLLYKELRSKS
Length265
PositionKinase
OrganismMucor ambiguus
KingdomFungi
LineageEukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Mucorineae> Mucoraceae> Mucor.
Aromaticity0.14
Grand average of hydropathy-0.063
Instability index48.30
Isoelectric point5.91
Molecular weight31244.76
Publications

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblFungi
GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding	GO:0000979	IEA:EnsemblFungi
GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription by galactose	GO:0000411	IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle	GO:0010673	IEA:EnsemblFungi

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP02486
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     254.50|      70|     102|      24|      93|       1
---------------------------------------------------------------------------
   24-   93 (111.61/72.47)	SKEEDLKY..VSEADYVKLRIWF.CHLIQKLAKRLQLRQQVVATAFVYFKRFYLNNSIKATDPILVLVTCVYL
  127-  198 (103.24/66.53)	SKVAEFEFylLEELEFY.LIIWHpYRSLTQICNELGMRESGLQYAWFIVNDSYRTDVSLLYPPHLISLAAIYI
  203-  241 (39.65/21.44)	.NHADFTP..GSAGDQRDMKQWF.ADLNVDIKSVIEISQEILA..............................
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP02486 with CycC domain of Kingdom Fungi

Unable to open file!