<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02481

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMLTDSSLTNILVVSGVSQIRYRVYNQHITRESLEIFLSHSPEDAVNKDMTLLRAYTEMVALGIPSLWRIHAESNEPGKDLELELWVFWFDERHTGKIDANDNLYALDETKVGSFTWENAYSKIQSPTASPGASSTQSKTSIPVTVSDEYKWFIKSVRNLIHVQMKKNGAFPLGEFYIYPNTDQDVISDVKSNHASASPSLLQLTQSVLCCSYSIYLASTNLIFQPNTRRMRLRPITIQTIRTRGKKVIISPTGETMLIANNSTTQSLSPQLEEAILKKWSLMLDIPYTNLMPYASPSQQHASYDRSQTPSSTVHPQPAHKPHAQLQLPNLVAIKSLTAGEESYYYPSCLIFVSSSSKISPTAMAGVNGLFGFNQGFSEDLGDKWHRWAWSERISNYWEYACPREVTTSVVLDTLSVDNGQNNNNSAGLLQKAISEPVIASPLMATKSVATPGSATGNQRNEMSTPSSSTNNYDEDDQQQQPQQPQLQHQLHQRSKSKNQSGLSLVDFAMAHFSIPNSTDDLVEYPILPHNTPVIQQTNENQHQPILQQQQQQQHHQPQQPQPQQPQQQLQHHQDNMVAISNNTTSNNSTYQSPQMPNLELDAYGGMVESMDVDSMVLDIPNRWTDDGMDDLDNFDFGVTEEDFDFFESSGPATAPAASGPLASMPVSLQQVQQAATIDATTAMTTNDPLMMMQDIKPEEMDITSDFNSTLMDLDQKQQQAILDTDLDSQQNDLSLTPLQVGMAQHDLFNSHTSDPVKYQDPKQNTKLSPRPAPLPQYDYHHQLFVPSQFAPIKIESVVNDAKYIQGGKFTYPVQENQPLAKRKQSADYRPDYVPVMRSSKKNKRKSSKLLLLDTINKENKPLELLDEMMLSREDQQLNSKSTTITSSSSSQEEEDASSSDQSSGSSTEEDDDEAFDDHHSVDGDYNDSNEDITTKITRTMKSLSLAQSKFVGKLTRIDTPVETTMKKKVDVDQIMMDYDAPFARAVTDSVIRIAGARTDVNEHEETQALDYLCQQAVMGGYPFSGGIEAMASNGFEANEGESAKVVIARRRNLLQKYNGDTIHVPSTPSDVEFMNQNFKHVLSDIFYQQQQPGNSDLDAMCIDSLPLPASVTIKGPLNVQDYYELSETNQAHSKYGKYQVKKRRPAEPNLGTLQPPNITVSRQDDMIEGTSKLIMFWEKLRLEPYSLKKQGLSTVYETCQLGIHHPAANIGPYRRGLVPVTLLPQLENESFHDRQLRSYMAECQHFGSVLGSALPENVHIIIYMINPATHLASHLDLSRCFSKLKAAYDTSPMALGSRLSDKTRARLVLQLMPIEHVLRSTSFGGCLKFGMKEIAFSVYSKCHTVVSRQQQTTPTTNDIKQDPHPVSDLYAPPFVLSKPIPSQIHFKLKKAISAFPSILEGHAVLHMGYTFSLDKRWMIIVWTDNRGEMVEFAVLDNHRHQLPLSSVFGEAWDRTKQISKRTGFAWTFVICKMGLVFEEELTAWIACLPSNEHVAIVSLDVESTLYVNTTNADTMNEMHTPTDALNANTPTMMNNAASTTKKMFSSDTQDNGQTKALLLNHRVAYSNKRERMSYGMLGLDSISKEDWMIPLASGYMIHTPPTTENPNNELFNCNPLVLEIHLVYNQTNHSAYSTLRDIIKKYHALSFVNVMPSNSNCFPIHLALVERLSRILLVVHS
Length1677
PositionKinase
OrganismMucor ambiguus
KingdomFungi
LineageEukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Mucorineae> Mucoraceae> Mucor.
Aromaticity0.07
Grand average of hydropathy-0.497
Instability index52.49
Isoelectric point5.55
Molecular weight188177.45
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02481
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     125.80|      38|      42|     668|     708|       1
---------------------------------------------------------------------------
  668-  708 (61.09/40.12)	LQQVQQAATIDATTAMTTNDPLMMMQDIKPEEMDItsdFNS
  713-  750 (64.71/35.53)	LDQKQQQAILDTDLDSQQNDLSLTPLQVGMAQHDL...FNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.46|      14|      15|     543|     556|       2
---------------------------------------------------------------------------
  478-  492 (25.92/12.97)	QQQPQQPQLQhQLHQ
  543-  556 (30.45/16.63)	QPILQQQQQQ.QHHQ
  559-  573 (30.08/16.33)	QPQPQQPQQQlQHHQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.95|      22|      42|    1181|    1202|       3
---------------------------------------------------------------------------
 1181- 1202 (38.73/21.03)	RLEPYSLKKQGLSTVYETCQ.LG
 1225- 1247 (36.23/19.26)	QLENESFHDRQLRSYMAECQhFG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      69.71|      16|      16|     886|     901|       4
---------------------------------------------------------------------------
  452-  466 (18.20/ 6.49)	.GSATGNQRNEMSTPS
  886-  901 (24.31/11.13)	SSSSSQEEEDASSSDQ
  903-  918 (27.20/13.33)	SGSSTEEDDDEAFDDH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.76|      11|      42|     574|     584|       5
---------------------------------------------------------------------------
  574-  584 (20.15/12.86)	DNMV.AISNNTT
  613-  624 (18.61/11.24)	DSMVlDIPNRWT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     126.60|      38|     229|      28|      65|       7
---------------------------------------------------------------------------
   28-   65 (64.21/44.07)	ITRESLEIFLSHSPEDAVNKDMTLL..RAYTEMVALGIPS
  258-  297 (62.39/42.58)	IANNSTTQSLSPQLEEAILKKWSLMldIPYTNLMPYASPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     123.61|      26|     453|     307|     334|       8
---------------------------------------------------------------------------
  307-  332 (46.97/23.81)	QTP..SSTVHPQPAHKP....HAQLQLPNLVA
  759-  790 (36.19/15.57)	QDPkqNTKLSPRPAPLPqydyHHQLFVPSQFA
  810-  834 (40.45/17.25)	TYP..VQENQPLAKRKQ....SADYR.PDYVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.27|      13|      16|      66|      81|      10
---------------------------------------------------------------------------
   66-   78 (24.52/23.28)	LWRIHAESNEPGK
   84-   96 (26.75/14.36)	LWVFWFDERHTGK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02481 with Med13 domain of Kingdom Fungi
Unable to open file!