Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSTSFVSKTSGPERSGSDRPNSSENQLGKAQIYNDICEYEETLGRLVTSVDKFHPDIQSARDLIEADKKLSDTLKSLQSYDEIDSRARRLDEEHSKTDTKIARILQTLTECHRDLNSLPMLEQVEFERNTMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGSVGPNNFVWPAEDAMRRGMLAIASLRASENGNEKLTTQDSSILQQDAPNETGEEYTGAPDADTEVRDRRPSFEFTGAAVKDVEEEKQEDDIDLDLDLFNAEEF |
Length | 266 |
Position | Middle |
Organism | Lachancea lanzarotensis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Lachancea. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.809 |
Instability index | 50.20 |
Isoelectric point | 4.58 |
Molecular weight | 30122.88 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP02473 No repeats found |
MoRF Sequence | Start | Stop |
1) EYTGAPDADTEVRDRRPSFEFTGAAVKDVEEEKQE 2) IDLDLDLFNAEEF | 217 254 | 251 266 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab