<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02470
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSTNGTNEIAALYPPPPPYIKHFTAENVAKIEELKKSGASFDHLDDDLEHLVSPEIPAEGHYRAFGSVWQVKDELPDLASMGMTQLYQSRETPEGASSSYQDKIQELHKLLRSLLLNFLELTGILSVNPEQFAAKVEHIQTILVNIHHLLNEYRPHQSRESLIMLLEEQLEGKRQEIQNIEKVCAQVKEKLIQMVGETQEDEDGRDP |
| Length | 207 |
| Position | Middle |
| Organism | Lachancea lanzarotensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Lachancea.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.542 |
| Instability index | 53.02 |
| Isoelectric point | 4.91 |
| Molecular weight | 23537.27 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP02470
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.66| 20| 72| 87| 109| 1
---------------------------------------------------------------------------
53- 76 (29.35/14.49) SPEIPaEGHYRAFGSVWQvkdELP
89- 108 (36.30/20.61) SRETP.EGASSSYQDKIQ...ELH
---------------------------------------------------------------------------
|