<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02447

Description Mediator of RNA polymerase II transcription subunit 11
SequenceMSSPGSSSSSASSASSSSIVFDPNTLQQQQPAPADLPPPPPPTNPDQASNQVLSSLNPTIESSSQSTVFNLSGFSNNSNLLQSQITDLTSLANTQSTVPHASQPASKNAPATAPSRGWMSQRKGKAIHIDDDQASLRNELPGDLESDQSERYTSSTSSQRIIELGVVEDQLAQLLNLASDVLGSLGPSLNEDESTNTAIETFSSSINEYFELLNKIQLGLRTSMSHLRVSRVSTRILFEPAHVSIPNCPVGLGDLTLSANHLSSRPSTHPLHADSLKDKDEEEPPALSLGSLVAERNAWQDLVESLELIKAQRTVL
Length316
PositionHead
OrganismPuccinia triticina (isolate 1-1 / race 1 (BBBD)) (Brown leaf rust fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
Aromaticity0.03
Grand average of hydropathy-0.440
Instability index69.78
Isoelectric point4.72
Molecular weight33742.73
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364147
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP02447
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.92|      24|     128|      48|      77|       1
---------------------------------------------------------------------------
    6-   29 (38.76/18.00)	SSSSSASSASSSSIVFDPNTLQQQ
   54-   77 (40.15/15.48)	SSLNPTIESSSQSTVFNLSGFSNN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.20|      24|      43|     140|     163|       2
---------------------------------------------------------------------------
  140-  163 (40.42/22.49)	LPGDLESDQSERYTSSTSSQRIIE
  185-  208 (39.78/22.03)	LGPSLNEDESTNTAIETFSSSINE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP02447 with Med11 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MSSPGSSSSSASSASSSSIVFDPNTLQQQQPAPADLPPPPPPTNPDQASNQVLSSLNPTIES
2) QSQITDLTSLANTQSTVPHASQPASKNAPATAPSRGWMSQRKGKAIHIDDDQASLRNELPGDLESDQSERYTSS
1
82
62
155

Molecular Recognition Features

MoRF SequenceStartStop
NANANA