<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02446
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MATELSIAGVVDAQLYPSILNRLANHAHSFAAFHSAEIGFQRAEPSEDTNILRLKHTTRHPQIINNHAPANYKNPLRNGCSLTAQGRIEPERLSPEFSIRPIHFCPIIAGDPLEFLSALGYRRTFEYVRRGVQFVRGGVVIEIFRVYQSEKDETAIAGEQTYLITVTAIIPTLARSTTTTTTPAATGAPAGTTNPNTTNTTTTAATTTTTAPAPAAGSGPSVQELRSEACARIREIQAILKGLADLGRVEPF |
Length | 252 |
Position | Head |
Organism | Puccinia triticina (isolate 1-1 / race 1 (BBBD)) (Brown leaf rust fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.186 |
Instability index | 49.26 |
Isoelectric point | 7.81 |
Molecular weight | 27207.40 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02446
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.88| 20| 27| 172| 195| 1
---------------------------------------------------------------------------
172- 195 (33.20/19.00) TlarsTTTTTTPAAT.....GAPAGTTNP
196- 220 (32.68/12.07) N....TTNTTTTAATttttaPAPAAGSGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.95| 25| 27| 80| 104| 2
---------------------------------------------------------------------------
80- 104 (45.52/27.97) CSLTAQGRIE.....PERLSPEFSIRPIHF
105- 134 (40.43/24.13) CPIIAGDPLEflsalGYRRTFEYVRRGVQF
---------------------------------------------------------------------------
|