<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02445
| Description |
Uncharacterized protein |
| Sequence | MNSTIAGLAIPDSDLCHVQWRSLAWILEHGPLTESNALDYFALSPFYDRKSTNQVLRMQSMFSGQSKMDPASEQEALRRFVGIEYALVLSRPEPDREGGLFIIEKRDRRGYDEYYPIASYYILKTSIYQAPSLYATLSARVLTSLSALKELLELARQHKPTYDPRQSYAWKIKEKPENTDPSSSLDKQSADQPTSESKREIDPTAQESDKMDIDMAAAPEKADGLAKTTAKKDTKDTPELANPILFRALQNTINNFPGFRPPTAVNPVPE |
| Length | 270 |
| Position | Head |
| Organism | Puccinia triticina (isolate 1-1 / race 1 (BBBD)) (Brown leaf rust fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.624 |
| Instability index | 62.48 |
| Isoelectric point | 5.44 |
| Molecular weight | 30408.89 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02445
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.90| 21| 21| 180| 200| 1
---------------------------------------------------------------------------
180- 200 (34.70/19.42) DPSSS.LDKQSADQPTSESKRE
202- 223 (29.20/15.34) DPTAQeSDKMDIDMAAAPEKAD
---------------------------------------------------------------------------
|