<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02443
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MWGSGARAKGKAPTMARQQRDSTSIFTTKLPAKTTSQKTRRARTRDTQQLQQTTMSTVPTEPPAPPASSTSKTDEAGEVKYGGYTRFELELEFVQSLGNPVYLNHLAAQKLLSQPAFVAYLAYLQYWTRPPYVKYLTYPGPTLRNLELLQQERFRQDIISPDLVQGMIQGGMRAAVEWHKKT |
Length | 182 |
Position | Middle |
Organism | Magnaporthiopsis poae (strain ATCC 64411 / 73-15) (Kentucky bluegrass fungus) (Magnaporthe poae) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Magnaporthales> Magnaporthaceae> Magnaporthiopsis.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.653 |
Instability index | 51.61 |
Isoelectric point | 9.90 |
Molecular weight | 20555.19 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02443
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 87.33| 26| 29| 11| 36| 1
---------------------------------------------------------------------------
11- 36 (44.98/23.69) KAPTMARQQRDSTSIFT..TKLPAKTTS
41- 68 (42.35/21.96) RARTRDTQQLQQTTMSTvpTEPPAPPAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.28| 17| 52| 79| 95| 2
---------------------------------------------------------------------------
79- 95 (31.36/23.29) VKYGGYTRFEL.ELEFVQ
133- 150 (26.92/18.99) VKYLTYPGPTLrNLELLQ
---------------------------------------------------------------------------
|