<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02428
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDAVIDARFERVEKALGALIDSISKYNPSISRVSDLVLADKELQDGLRNVQRHQNNVLRIHKLKATTAGLDAQIRSTLEVLASTRKDMTATPSTVFPDRIPNPISFEELLGFARRISKTTLPPPGVTNGVDLDGTGGEMTPGGGPAILTTGQDAGASTPAGPVPQTPTGPVSVAATPTPMSTVVNGGVGTPAPGTPSNVRHDTAMLDAPPQQAPQGGGGGLRGSAGSGAQSPTATSPTIKKQFQFTAFDDDDSDNSD |
| Length | 257 |
| Position | Middle |
| Organism | Magnaporthiopsis poae (strain ATCC 64411 / 73-15) (Kentucky bluegrass fungus) (Magnaporthe poae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Magnaporthales> Magnaporthaceae> Magnaporthiopsis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.370 |
| Instability index | 43.52 |
| Isoelectric point | 5.22 |
| Molecular weight | 26473.20 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02428
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.43| 14| 15| 137| 151| 1
---------------------------------------------------------------------------
137- 151 (23.48/14.59) GEMTPGgGPAILT.TG
155- 169 (23.95/ 9.98) GASTPA.GPVPQTpTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.27| 12| 15| 171| 183| 2
---------------------------------------------------------------------------
171- 183 (16.78/ 9.76) VSVAATPTPmSTV
188- 199 (23.49/ 9.79) VGTPAPGTP.SNV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.97| 23| 27| 79| 104| 3
---------------------------------------------------------------------------
79- 104 (34.46/26.32) EVLASTRKdmtATPSTVFPDRIPNPI
108- 130 (39.51/21.84) ELLGFARR...ISKTTLPPPGVTNGV
---------------------------------------------------------------------------
|