<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02424
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEEEEAELRNPFPSPPSHYTNYTTHNLDLLKLLKERVDDGDVSQVNQHEVLSDQTDVPDWPLTQLERPRVDWIREEGAWTVFGDTWPIEERHATLAELGMTQLYPSDPNIDRRPALLTVLKSMLVTYSHMLNGLLAPPPTTTSSNLPEEWRRHTEWIGTMSLNLTAAANELRPVQARGNLELMMRRQLGLRREETQSIHAKCDELEAKLSQLSGSALEASKGYDDAEEGSTSTEAIQVEGLAGATVCPFHLSAKKRLFIDYTSRLLLLPR |
Length | 270 |
Position | Middle |
Organism | Phlebiopsis gigantea 11061_1 CR5-6 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Phanerochaetaceae> Phlebiopsis.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.545 |
Instability index | 51.96 |
Isoelectric point | 4.98 |
Molecular weight | 30553.03 |
Publications | PubMed=25474575
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02424
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.18| 21| 23| 82| 104| 1
---------------------------------------------------------------------------
84- 104 (38.32/23.96) DTWPIEERHATLAEL.GMTQLY
106- 127 (28.86/10.74) SDPNIDRRPALLTVLkSMLVTY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.82| 23| 23| 133| 155| 2
---------------------------------------------------------------------------
133- 155 (42.00/24.05) GLLAPPPTTTSSNL.PEEWRRHTE
158- 181 (32.82/17.42) GTMSLNLTAAANELrPVQARGNLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.76| 10| 30| 29| 38| 3
---------------------------------------------------------------------------
29- 38 (15.97/ 8.84) LLKLLKERVD
62- 71 (17.78/10.54) LTQLERPRVD
---------------------------------------------------------------------------
|