<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02421
| Description |
Uncharacterized protein |
| Sequence | MAEIPQTDVSRRAALPTASLLSRSSQPTIDQNSDEYLQAIEEEWNKKVDVEVDTLVESMVDLVSLASIGDKDKLRVAQEAFQAQCRAESMIRAAHSLLSIIHSMKLMLLLSDEAQIATRRDGELRTVKAEKEEAKKKVAALLDELLRPESQDTSTTQNETRMKE |
| Length | 164 |
| Position | Head |
| Organism | Phlebiopsis gigantea 11061_1 CR5-6 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Phanerochaetaceae> Phlebiopsis.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.483 |
| Instability index | 45.28 |
| Isoelectric point | 4.94 |
| Molecular weight | 18368.61 |
| Publications | PubMed=25474575
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02421
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.68| 18| 30| 57| 74| 1
---------------------------------------------------------------------------
57- 74 (30.30/21.83) ESMVDLV.SLASIGDKDKL
88- 106 (26.38/18.21) ESMIRAAhSLLSIIHSMKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.98| 19| 87| 20| 55| 2
---------------------------------------------------------------------------
35- 53 (32.43/10.58) EYLQAIEEEWNKKVDVEVD
125- 143 (28.56/18.30) RTVKAEKEEAKKKVAALLD
---------------------------------------------------------------------------
|