| Description | Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MGVTGLARWVNAPTTSLDLISQNIARNHQGQARGKWHLSVKSFRSTLSAIPGFQVHSERTMCALTMNDNVFVLVEDPVAPSRADLLAQQLPEGQTPIPLTGPGAPKHYCKTFLTLNPPGALEQLLSQLRARWASVRQTSGANQLSHTAGQQLTVDGLVYSIGTDFVVRAGNVILAGGAVKGMLLEAEYLPLTAMHRSTDGTMELLTNLLVSILPNIPDAKTAAVTMSDSIWEEVLWDREQEEEEQANPKPPETDDINKVFVSGDEDMVTSKKGEWSGVDRDRRSAFLIIGALKSEGLL |
| Length | 298 |
| Position | Head |
| Organism | Phlebiopsis gigantea 11061_1 CR5-6 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Phanerochaetaceae> Phlebiopsis. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.187 |
| Instability index | 43.28 |
| Isoelectric point | 5.30 |
| Molecular weight | 32393.44 |
| Publications | PubMed=25474575 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP02420
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.86| 24| 36| 80| 114| 1
---------------------------------------------------------------------------
51- 90 (29.01/33.37) PGFQVHSERTMcaLTmndnvfvlvedpvaPSRADLLAQQL
102- 128 (39.85/17.79) PGAPKHYCKTF..LT...........lnpPGALEQLLSQL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GVDRDRR 2) SKKGEW | 277 270 | 283 275 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab