<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02418
| Description |
Uncharacterized protein |
| Sequence | MRLYRAKRDSTRPRVADKYAILGFISSGTYGRVYKAQSKDSDGRIHAIKKFKPDKEGDVITYTGISQSAIREIALNREISHENVVALKEVILEDKSIYMVFDYAEHDFLQLIHHHSQTLRSAISVPVLKSLTFQLLNGLLYLHSCHIIHRDLKPANILINSQGVVKIGDLGLARLTYQPLQPLLSGDKVVVTIWYRAPELLLGAKHYNKAVDLWAIGCVVAELASLRPIFKGEEAKLDSKKNVPFQRDQILKIFEILGTPDERDWPGVIHMPEHANMKKLDFYPNHLLTWCETRLKSQLAYEFLKATFIYDPNQRLTARAALEHGWFNEEPKPTEK |
| Length | 336 |
| Position | Kinase |
| Organism | Phlebiopsis gigantea 11061_1 CR5-6 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Phanerochaetaceae> Phlebiopsis.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.268 |
| Instability index | 39.36 |
| Isoelectric point | 9.08 |
| Molecular weight | 38466.01 |
| Publications | PubMed=25474575
|
Function
| Annotated function |
|
| GO - Cellular Component | euchromatin GO:0000791 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP02418
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.28| 13| 41| 128| 140| 1
---------------------------------------------------------------------------
128- 140 (22.23/13.76) LKSLTFQLLNGLL
172- 184 (24.05/15.40) LARLTYQPLQPLL
---------------------------------------------------------------------------
|