<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02416
Description |
Uncharacterized protein |
Sequence | MRDTPRAMSDILLQPLNDLQTLTHTLFHSLSPSQTRPPPVPPISAFLEADAALAEAAKLARQHQIKQRKNERLKDVFLALEERWREVVQELEKGKRELDAILTESEVRIKNIEVAKTGTLRSLSSFTSAPPNMPELVPGQPPPPLFYPPFPNEEKMRRGHMNDEAPLGMLGETHDAGKAPTITPRSVELPPHLAGTNPYRQDHRIPQQQIFDLDLDLNPDL |
Length | 221 |
Position | Middle |
Organism | Phlebiopsis gigantea 11061_1 CR5-6 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Phanerochaetaceae> Phlebiopsis.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.623 |
Instability index | 65.09 |
Isoelectric point | 5.83 |
Molecular weight | 24898.12 |
Publications | PubMed=25474575
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02416
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.94| 13| 104| 30| 42| 1
---------------------------------------------------------------------------
30- 42 (28.03/10.26) LSPSQTRPPPV..PP
123- 135 (23.80/ 7.80) LSSFTSAPPNM..PE
136- 149 (22.11/ 6.81) LVPGQP.PPPLfyPP
---------------------------------------------------------------------------
|