Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MTDTLNVPLNTLTQLSTALFQSLSSQPHTHGGRQGEPPPPVSAFLSAETALVHALVETAAHQRRQHHINKLVSEISKLDARWREIVEKIEQGRKELESVVREGEERVEGIKKAKEAAIPYPELLAYAQSLSAFTSAPPNMPDPNAPLSAVHGAPVPLFFPPFPNEEKMRRGRLNVEKPLGRLGESHSVKREPAPSPSPKQKANARDRPGAHPYRHEIRAQQTEFDLDLDLNPDL |
Length | 234 |
Position | Middle |
Organism | Pisolithus tinctorius Marx 270 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Boletales> Sclerodermatineae> Pisolithaceae> Pisolithus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.674 |
Instability index | 61.39 |
Isoelectric point | 6.81 |
Molecular weight | 25955.01 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02407 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.12| 15| 15| 123| 137| 1 --------------------------------------------------------------------------- 123- 137 (25.05/12.33) LLAYAQSLSAFTSAP 140- 154 (29.07/15.22) MPDPNAPLSAVHGAP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.55| 14| 15| 77| 90| 2 --------------------------------------------------------------------------- 77- 90 (24.38/16.30) K.LDARWREIVEKIE 94- 108 (18.17/10.68) KeLESVVREGEERVE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GRLGESHSVKREP 2) PKQKANARDRPGAHPYRHEIRAQQTEFDLDLDLNPDL | 180 198 | 192 234 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab