| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MTDTLNVPLNTLTQLSTALFQSLSSQPHTHGGRQGEPPPPVSAFLSAETALVHALVETAAHQRRQHHINKLVSEISKLDARWREIVEKIEQGRKELESVVREGEERVEGIKKAKEAAIPYPELLAYAQSLSAFTSAPPNMPDPNAPLSAVHGAPVPLFFPPFPNEEKMRRGRLNVEKPLGRLGESHSVKREPAPSPSPKQKANARDRPGAHPYRHEIRAQQTEFDLDLDLNPDL |
| Length | 234 |
| Position | Middle |
| Organism | Pisolithus tinctorius Marx 270 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Boletales> Sclerodermatineae> Pisolithaceae> Pisolithus. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.674 |
| Instability index | 61.39 |
| Isoelectric point | 6.81 |
| Molecular weight | 25955.01 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP02407
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.12| 15| 15| 123| 137| 1
---------------------------------------------------------------------------
123- 137 (25.05/12.33) LLAYAQSLSAFTSAP
140- 154 (29.07/15.22) MPDPNAPLSAVHGAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.55| 14| 15| 77| 90| 2
---------------------------------------------------------------------------
77- 90 (24.38/16.30) K.LDARWREIVEKIE
94- 108 (18.17/10.68) KeLESVVREGEERVE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GRLGESHSVKREP 2) PKQKANARDRPGAHPYRHEIRAQQTEFDLDLDLNPDL | 180 198 | 192 234 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab