<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02396
Description |
Uncharacterized protein |
Sequence | MLSGVTQAKVYAYEVALFGEFFARDLKAILNRITLHTESAAPMHTREIVFEHLGTHLLQSQGEEPVLLRARKDVGDGDAKESGWTLYSYLKPESVRVHPEATVRPWATCEVMGDALSLASALGYVQRSQIYKRGYVFRRGPLIIQMFQQGQVDPKTSLPIPAHTDTLWEVEVKTATPVNTTAPQSGQMQVNTVRSAIEAVLEVQLIMKGLLDLRRQDI |
Length | 218 |
Position | Head |
Organism | Pisolithus tinctorius Marx 270 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Boletales> Sclerodermatineae> Pisolithaceae> Pisolithus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.162 |
Instability index | 42.20 |
Isoelectric point | 6.60 |
Molecular weight | 24360.69 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02396
No repeats found
No repeats found
|