<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02390
| Description |
Uncharacterized protein |
| Sequence | MLQDLSHMDRITQLQDEIQRFLVIMSSSIAYLTTRSTFLQVSEEIPITKQRNPDKFDPPEVFEANKKELVDDLIMKAKQIEVLIQSLPVPEPEEQQAKRLQDLENEMTVANQEYIQAVERAKSLHGQFSELLRTMLDKADIEASLLSGQKPN |
| Length | 152 |
| Position | Middle |
| Organism | Pisolithus tinctorius Marx 270 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Boletales> Sclerodermatineae> Pisolithaceae> Pisolithus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.491 |
| Instability index | 65.36 |
| Isoelectric point | 4.75 |
| Molecular weight | 17496.78 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02390
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.94| 19| 19| 85| 103| 1
---------------------------------------------------------------------------
85- 103 (32.41/18.00) QSLPVPEPEEQQA.KRLQDL
105- 124 (26.54/13.76) NEMTVANQEYIQAvERAKSL
---------------------------------------------------------------------------
|