Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSQQTAGGELTFTPFTTAERIQQLNEIDKSITSLLHSAGLALQTLGSSAAHSSSSPIKNKREAFQEISNAYLRTLQSVDVRMRRQIYGLEEADIIPGEKIKAKGEGQETTLGGTSAVIVGQGVGGKEEALISVGDGGMGKLDIGWLNSRSQSVDRDMEAELWEKAKIFLEGLEKVDEKGTASEINPQAMDT |
Length | 191 |
Position | Head |
Organism | Oidiodendron maius Zn |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Myxotrichaceae> Oidiodendron. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.412 |
Instability index | 44.83 |
Isoelectric point | 4.90 |
Molecular weight | 20526.76 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02377 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 167.63| 59| 64| 60| 121| 1 --------------------------------------------------------------------------- 44- 108 (89.93/71.10) TLGSSAAHSSSSpiknKREAFQEISNAYLRTL.........QSVDVRMRRQIYglEEADI.IPG.EKIKAKGEGQE 110- 183 (77.70/50.15) TLGGTSAVIVGQgvggKEEALISVGDGGMGKLdigwlnsrsQSVDRDMEAELW..EKAKIfLEGlEKVDEKGTASE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DMEAELWEKAKIFLEGLEKV 2) KLDIGWLNSRS | 156 140 | 175 150 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab