| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDVVIDGRFERVENALAKLINSISAYNPSPALATDLVTADAELSEGLDQLSVHQTNHAKLISLRNTSAALDQQIKETLVLLTDTRRALIDTPSTIFPEHTNPVSYSDLLSYARRISKFTLPNSYRESEARAESPQATSSTPKDGKTESQADETSTPAAIANGADKDMQMTGVGRDSATPAAIQSQNTTATSTSLPEGFTQFLNPLADAPFIPWPTEETIRRGALASIQVLLDQNIDPATFDPAKSAELEAERKRIAEEEDRAREEQKVKAEEERRKEMERRMSVSGNAAAAGREQEKPGVFQLETFDDDDESD |
| Length | 313 |
| Position | Middle |
| Organism | Oidiodendron maius Zn |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Myxotrichaceae> Oidiodendron. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.654 |
| Instability index | 46.29 |
| Isoelectric point | 4.62 |
| Molecular weight | 34282.34 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP02372
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.11| 20| 21| 47| 66| 2
---------------------------------------------------------------------------
47- 66 (34.76/25.66) LDQLSVHQTNHAKLISLRNT
70- 84 (22.28/13.92) LDQ.QIKET....LVLLTDT
89- 104 (21.06/12.77) IDTPSTIFPEHTNPVS....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.67| 17| 22| 236| 253| 4
---------------------------------------------------------------------------
236- 253 (24.80/19.48) DPATFDPAKSAElEAERK
260- 276 (27.87/17.03) DRAREEQKVKAE.EERRK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) RRKEMERRMSVSGNAAAAGREQEKPGVFQLETFDDDDESD 2) YSDLLSYARRI | 274 105 | 313 115 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab