Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDVVIDGRFERVENALAKLINSISAYNPSPALATDLVTADAELSEGLDQLSVHQTNHAKLISLRNTSAALDQQIKETLVLLTDTRRALIDTPSTIFPEHTNPVSYSDLLSYARRISKFTLPNSYRESEARAESPQATSSTPKDGKTESQADETSTPAAIANGADKDMQMTGVGRDSATPAAIQSQNTTATSTSLPEGFTQFLNPLADAPFIPWPTEETIRRGALASIQVLLDQNIDPATFDPAKSAELEAERKRIAEEEDRAREEQKVKAEEERRKEMERRMSVSGNAAAAGREQEKPGVFQLETFDDDDESD |
Length | 313 |
Position | Middle |
Organism | Oidiodendron maius Zn |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Myxotrichaceae> Oidiodendron. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.654 |
Instability index | 46.29 |
Isoelectric point | 4.62 |
Molecular weight | 34282.34 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02372 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 78.11| 20| 21| 47| 66| 2 --------------------------------------------------------------------------- 47- 66 (34.76/25.66) LDQLSVHQTNHAKLISLRNT 70- 84 (22.28/13.92) LDQ.QIKET....LVLLTDT 89- 104 (21.06/12.77) IDTPSTIFPEHTNPVS.... --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.67| 17| 22| 236| 253| 4 --------------------------------------------------------------------------- 236- 253 (24.80/19.48) DPATFDPAKSAElEAERK 260- 276 (27.87/17.03) DRAREEQKVKAE.EERRK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RRKEMERRMSVSGNAAAAGREQEKPGVFQLETFDDDDESD 2) YSDLLSYARRI | 274 105 | 313 115 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab