Description | Uncharacterized protein |
Sequence | MADRLTQLQDAVDQLANQFVASLYYINKHHDLQTLSATDTVRQEKKIEGDQDPGEKEVDPYPADVFRAGQKELAQDLIIKEQQIEAFISMLPGLDNSEKDQQDTIRQLEEELMAAEQKRKEAVKEKEAVLARLESVIRSVKRP |
Length | 143 |
Position | Middle |
Organism | Oidiodendron maius Zn |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Myxotrichaceae> Oidiodendron. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.764 |
Instability index | 49.87 |
Isoelectric point | 4.79 |
Molecular weight | 16349.18 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi transcription corepressor activity GO:0003714 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP02371 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 112.38| 35| 36| 39| 73| 1 --------------------------------------------------------------------------- 39- 73 (60.07/37.65) DTVRQEKKIEG..DQDPGEKEVDPYPADVFRAGQKEL 76- 112 (52.31/31.96) DLIIKEQQIEAfiSMLPGLDNSEKDQQDTIRQLEEEL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EAVKEKEAVLAR 2) VRQEKKIEGDQDPGEKEVDPYPADVFRAGQKELAQDLIIKEQQIEAFISMLPGLDNSEKDQQDTIRQLEEELMA | 121 41 | 132 114 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab