<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02369
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MASKDPPLDEIVWRSPEYAQQMQGIHSNSILFYFAGSPFFDPTSNNAILFSQAMYNQNMLPIIQTREAFQARLKTMSGLEFMVAQEPAETAPNTGTGVWVIRKQTRRKRLPEEDEITVHSSYFVVGENIYMAPTVGDVLSILSSMNKFLSTASALPDFSPSLGYTYILPSSSTRLKAIESQLGQASKEGTPVPEVPNSKKAPSASNISNYLDTRLLEESLNIAMKYGDEYMDENPITGQPGDFHLSTTGRDKDKLVMPISKDPVSVGGRPGGMPKLDTDIAPARKGSKSEKSPKTPGGGIPKPKRRKSKALSAGGITPK |
Length | 319 |
Position | Head |
Organism | Oidiodendron maius Zn |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Myxotrichaceae> Oidiodendron.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.480 |
Instability index | 60.76 |
Isoelectric point | 9.00 |
Molecular weight | 34792.18 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02369
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.47| 15| 15| 288| 302| 1
---------------------------------------------------------------------------
288- 302 (29.95/16.65) KSEKSPKTPGGGI.PK
304- 319 (22.52/10.81) KRRKSKALSAGGItPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 140.46| 43| 107| 50| 92| 2
---------------------------------------------------------------------------
50- 92 (75.15/57.39) FSQAMYNQNMLPIIQTR.EAFQARLKTMSGLEFMVAQEP.AETAP
158- 202 (65.31/48.82) FSPSLGYTYILPSSSTRlKAIESQLGQASKEGTPVPEVPnSKKAP
---------------------------------------------------------------------------
|