<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02365
| Description |
Uncharacterized protein (Fragment) |
| Sequence | LARWLNAPPTGLQLVRDNLLLNHNAQYRGKWHLSVKSYRSILGQIPGYHVSSERNMYALTLDENVFILLEDPAAPNRADVLAAAPPGQETVYLHSPSHYRNTFLTLRPPGALDQLLAQIKARWVSVRQNTSGPTQRNPTGGQQLLIDGHTFSIGTDWLAEYLPLPVLHSAIADGTSELLSNLLTSILPNIRDAKTVAVTISDAQWEDVLWDREEENRSLKNQTSDSKDNNPYAWDADEITNWKQGDWVGVDRDQRSAFLIVGALRSEGLL |
| Length | 270 |
| Position | Head |
| Organism | Hebeloma cylindrosporum h7 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Cortinariaceae> Hebeloma.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.403 |
| Instability index | 47.48 |
| Isoelectric point | 5.48 |
| Molecular weight | 30193.45 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02365
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.83| 18| 21| 69| 87| 2
---------------------------------------------------------------------------
69- 87 (28.40/21.21) LEDPaAPNRADVLAAAPPG
93- 110 (35.43/22.14) LHSP.SHYRNTFLTLRPPG
---------------------------------------------------------------------------
|