Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGFTGLARWVNAPTTGLQLVTDNLRMNHNGEYRGKWMLSVRSYRSTLGQSPGSQITSERTMCALTMDDNVFVHVEDPAAPTKADVLAAAPPGQEAAYLQSPSHYRTTFLTLTPPNALEQLISQLKARWVPVRQSSGAQKAQVLGPQLTIEGHIFAIGTDWLVRAGNVILAGGAVRGMLLEAEYLPLPALHSPTADGTSELLSNLLTSVLPNLRDAKTVAVTISDMQWEEVLWDREEDGRKEEEKEEETEFIYGDDDATSEKKGDWTGIDRDRRSAYLIMGALRSEGIL |
Length | 288 |
Position | Head |
Organism | Amanita muscaria Koide BX008 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Amanitaceae> Amanita. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.331 |
Instability index | 58.82 |
Isoelectric point | 4.94 |
Molecular weight | 31696.37 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02336 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 247.65| 79| 85| 64| 143| 2 --------------------------------------------------------------------------- 64- 143 (131.80/91.23) LTMDDNVFVHVEDPAAPTKADVLA.AAPPGQ..EAAYLQSPSHYRTTFLTLTP..PNALEQLISQLK.ARWVPVrQSSGAQKAQVL 147- 231 (115.85/75.42) LTIEGHIFAIGTDWLVRAGNVILAgGAVRGMllEAEYLPLPALHSPTADGTSEllSNLLTSVLPNLRdAKTVAV.TISDMQWEEVL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ETEFIYGDDD 2) SEKKGDWTGIDRDRRSAYLIMGALRSEGIL | 247 259 | 256 288 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab