Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MESSLREQVREHITEYSELVKNYFTALSSVAENNVVDNVHGPDQIIKKMANVDDKLQKAVEHIENHQIRQQQIIQVQDEIQQHNIALLEIIQKLGAVREELDLSLTQAKVELKSIKYANESNVQFTDVLSYASKLSKYTSAPPNFDNVNKDIKVDFEKPYPDEERMRRGLLYWQNAPQQQMEDKFESSEDDMSANEEMEEISTNEQTEETGGDPFWILDLNPDMQS |
Length | 226 |
Position | Middle |
Organism | Parasitella parasitica |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Mucorineae> Mucoraceae> Parasitella. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.815 |
Instability index | 52.58 |
Isoelectric point | 4.50 |
Molecular weight | 26178.70 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02314 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.34| 15| 15| 61| 75| 1 --------------------------------------------------------------------------- 61- 75 (27.12/14.81) EHIENHQIRQQQIIQ 78- 92 (25.22/13.39) DEIQQHNIALLEIIQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MRRGLLYWQNA 2) QQQMEDKFESSEDDMSANEEMEEISTNEQTEETGGDPFWILDLNPDMQS | 166 178 | 176 226 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab