<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02313
| Description |
Uncharacterized protein |
| Sequence | MEQSQLQAQLDPNTYQELEALRGKLWSLQETFSTHLTYLKEPKFPFTWPDLLNKFNMLTAKFASLSEDFYSYTEKASNATLPKLMVHPYIPTTTEQETNILSVLLRTKLIPDIEKLEAETQATIAQELLSDNNNLPTASQMSHNADDEQLIHNQLNQWNHLLERHDRLAVDAANFISELSSDHRPNFMLRYEDQIDQEDDDQEDEEMGEEEEWEKMGFPSQEIWKKWKLECLLNFYSSGKNEVIGSDLKKLATTANNATKK |
| Length | 261 |
| Position | Head |
| Organism | Parasitella parasitica |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Mucorineae> Mucoraceae> Parasitella.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.764 |
| Instability index | 50.90 |
| Isoelectric point | 4.62 |
| Molecular weight | 30333.44 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02313
No repeats found
|