<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02302
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MNSYAAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQANGMEAATGGESAAPTPNVNGSASTADSQQTSSALQPVQAQPGNPQQQQQINGVASGANIKLELN |
Length | 199 |
Position | Middle |
Organism | Drosophila melanogaster (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.685 |
Instability index | 68.29 |
Isoelectric point | 5.71 |
Molecular weight | 23000.50 |
Publications | PubMed=10731132
PubMed=12537568
PubMed=12537572
PubMed=12537573
PubMed=12537574
PubMed=16110336
PubMed=17569856
PubMed=17569867
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02302
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.46| 15| 18| 62| 76| 2
---------------------------------------------------------------------------
62- 76 (30.05/18.30) YAKY...LMYPMCLYFLD
80- 97 (24.41/13.84) YEHFrreIVNSQCCKFID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.57| 10| 29| 152| 161| 4
---------------------------------------------------------------------------
152- 161 (17.63/11.25) NVNGSASTAD
184- 193 (17.94/11.54) QINGVASGAN
---------------------------------------------------------------------------
|