<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02301
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAKMYGKAAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQSFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKFIDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQANGMEAATGGESAAPTPNVNGSASTADSQQTSSALQPVQAQPGNPQQQQQINGVASGANIKLELN |
| Length | 202 |
| Position | Middle |
| Organism | Drosophila melanogaster (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.676 |
| Instability index | 68.81 |
| Isoelectric point | 6.73 |
| Molecular weight | 23314.99 |
| Publications | PubMed=10731132
PubMed=12537568
PubMed=12537572
PubMed=12537573
PubMed=12537574
PubMed=16110336
PubMed=17569856
PubMed=17569867
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02301
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.46| 15| 18| 65| 79| 2
---------------------------------------------------------------------------
65- 79 (30.05/19.98) YAKY...LMYPMCLYFLD
83- 100 (24.41/15.10) YEHFrreIVNSQCCKFID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.57| 10| 29| 155| 164| 4
---------------------------------------------------------------------------
155- 164 (17.63/13.59) NVNGSASTAD
187- 196 (17.94/13.94) QINGVASGAN
---------------------------------------------------------------------------
|