<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02298
Description |
Uncharacterized protein |
Sequence | MAGNFWQSSHHQQWLLDKQDLVRERQHDLSIFTEEEYQKLFIFFSNLIQVLGEQLKLRQQVIATATVYFKRFYARNSLKCIDPLLLAPTSVFLASKVEEFGVISHNRLIAACQTVVKNKFNYAYSQEFPYRGSHISECEFYLLEHLDCCLIVYQPYRPLLILIQDIGPDEQLLTLAWRIINDSLRTDVCLLYPPHQIAIGCLQIACVILQKDLKAWFAELNADMEKIQEIARYIINLYELWKTYDEKKEIQGLLSKMPKPTPSPPQH |
Length | 267 |
Position | Kinase |
Organism | Apis mellifera (Honeybee) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.106 |
Instability index | 53.90 |
Isoelectric point | 6.25 |
Molecular weight | 31284.95 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02298
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 23.27| 7| 26| 104| 113| 2
---------------------------------------------------------------------------
104- 113 ( 8.98/14.74) SHnrlIAACQ
133- 139 (14.29/ 9.00) SH...ISECE
---------------------------------------------------------------------------
|