<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02298
| Description |
Uncharacterized protein |
| Sequence | MAGNFWQSSHHQQWLLDKQDLVRERQHDLSIFTEEEYQKLFIFFSNLIQVLGEQLKLRQQVIATATVYFKRFYARNSLKCIDPLLLAPTSVFLASKVEEFGVISHNRLIAACQTVVKNKFNYAYSQEFPYRGSHISECEFYLLEHLDCCLIVYQPYRPLLILIQDIGPDEQLLTLAWRIINDSLRTDVCLLYPPHQIAIGCLQIACVILQKDLKAWFAELNADMEKIQEIARYIINLYELWKTYDEKKEIQGLLSKMPKPTPSPPQH |
| Length | 267 |
| Position | Kinase |
| Organism | Apis mellifera (Honeybee) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.106 |
| Instability index | 53.90 |
| Isoelectric point | 6.25 |
| Molecular weight | 31284.95 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02298
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 23.27| 7| 26| 104| 113| 2
---------------------------------------------------------------------------
104- 113 ( 8.98/14.74) SHnrlIAACQ
133- 139 (14.29/ 9.00) SH...ISECE
---------------------------------------------------------------------------
|