Description | Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
Sequence | MSDDSPHKRKRSLGDTGDRDRDQKKMHLGDSRLGIEDLHLDVGEKYLLCRTPHPEPLTRIAQDLYEMCGLTSLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEDAPSEFMAILQVPELEWNVHQVKGREITDGLSATTLSNLGRAMNMSKGPIPKAVWDSSVLGDLAPSSGNASKPISAKPSAPGTPLASTPNTIGRPKPPILAGQDPNRPRRNVKKRSYGDSSFEGYGEGYPDDDGGMDTGYSTGEGEGGQKRRKKVGYDSTNGNESLSSDMALKNTAASPPNALMRQQSYGPGMVGA |
Length | 309 |
Position | Head |
Organism | Metarhizium majus (strain ARSEF 297) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium> Metarhizium majus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.864 |
Instability index | 47.84 |
Isoelectric point | 8.99 |
Molecular weight | 33381.05 |
Publications | PubMed=25368161 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02294 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.80| 12| 14| 183| 194| 1 --------------------------------------------------------------------------- 183- 194 (22.17/11.79) ASKPIS.AKPSAP 199- 211 (19.63/ 9.64) ASTPNTiGRPKPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 97.00| 31| 85| 10| 44| 2 --------------------------------------------------------------------------- 10- 42 (46.73/36.60) KRsLGDTGDRDRdQKKMHLGDSR....LGIEDLHLDV 98- 132 (50.27/24.64) KR.LGVAGHFDV.QKKKEDAPSEfmaiLQVPELEWNV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ALMRQQSY 2) QKRRKKVGYDST | 295 262 | 302 273 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab