<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02278
| Description |
Uncharacterized protein |
| Sequence | MFVLINKLQKADPVLADIVVRLYRRVEAHMVMPQNQAILEAPGIQLDLGSGAGGLGDVDAMADVDVGADGMTVDGLDIGIGGPGSAGGLDATSDGDWFGGLDTNGMDMFGWGDSMDLSGN |
| Length | 120 |
| Position | Tail |
| Organism | Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae (strain ARSEF 23)) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | 0.122 |
| Instability index | 17.38 |
| Isoelectric point | 4.05 |
| Molecular weight | 12282.67 |
| Publications | PubMed=21253567
PubMed=25368161
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02278
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.22| 24| 29| 56| 81| 2
---------------------------------------------------------------------------
56- 81 (40.12/15.39) GDVDAMADVD.VGadGMTVDGLDI.GIG
87- 112 (40.10/11.89) GGLDATSDGDwFG..GLDTNGMDMfGWG
---------------------------------------------------------------------------
|