<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02277
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDDSPHKRKRSPGDTGDCDRDPKKMNLGDSRSGIEDLHLDVGEKYLLCRTPHPEPRTRISQDLYEMCGLTSLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEDAPSEFMAILQVPELEWNVHQVKGREISDGLSATTLSNLGRAMNMSKGPIPKAVWDSSVLGDLAPSGGGGNASKPISAKPSAPGTPLVSTPNTLARPKPPILAGHDPNRPRRNVKKRSYGDSSFEGYGEGYPDDDGGMDTGYSTGEGEGSQKRRKKVGYDSTNGNESLSSDMALKNTAASPPNALMRQQSYGPGMVGA |
| Length | 311 |
| Position | Head |
| Organism | Metarhizium album (strain ARSEF 1941) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.887 |
| Instability index | 49.99 |
| Isoelectric point | 8.92 |
| Molecular weight | 33442.03 |
| Publications | PubMed=25368161
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02277
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 257.77| 83| 208| 9| 95| 1
---------------------------------------------------------------------------
9- 95 (140.79/79.93) RKRSP...G.DTGDCDRDPKKMNLGDSR.SGI......EDLHLDVGekYLLCRTPHPEP.RTRISQDlyEMCGLTSLAAEVA.REKPNGEKNAL.RKTYKG
209- 305 (116.98/57.56) RPKPPilaGhDPNRPRRNVKKRSYGDSSfEGYgegypdDDGGMDTG..YSTGEGEGSQKrRKKVGYD..STNGNESLSSDMAlKNTAASPPNALmRQQSYG
---------------------------------------------------------------------------
|