Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDDSPHKRKRSPGDTGDCDRDPKKMNLGDSRSGIEDLHLDVGEKYLLCRTPHPEPRTRISQDLYEMCGLTSLAAEVAREKPNGEKNALRKTYKGHIKRLGVAGHFDVQKKKEDAPSEFMAILQVPELEWNVHQVKGREISDGLSATTLSNLGRAMNMSKGPIPKAVWDSSVLGDLAPSGGGGNASKPISAKPSAPGTPLVSTPNTLARPKPPILAGHDPNRPRRNVKKRSYGDSSFEGYGEGYPDDDGGMDTGYSTGEGEGSQKRRKKVGYDSTNGNESLSSDMALKNTAASPPNALMRQQSYGPGMVGA |
Length | 311 |
Position | Head |
Organism | Metarhizium album (strain ARSEF 1941) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.887 |
Instability index | 49.99 |
Isoelectric point | 8.92 |
Molecular weight | 33442.03 |
Publications | PubMed=25368161 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02277 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 257.77| 83| 208| 9| 95| 1 --------------------------------------------------------------------------- 9- 95 (140.79/79.93) RKRSP...G.DTGDCDRDPKKMNLGDSR.SGI......EDLHLDVGekYLLCRTPHPEP.RTRISQDlyEMCGLTSLAAEVA.REKPNGEKNAL.RKTYKG 209- 305 (116.98/57.56) RPKPPilaGhDPNRPRRNVKKRSYGDSSfEGYgegypdDDGGMDTG..YSTGEGEGSQKrRKKVGYD..STNGNESLSSDMAlKNTAASPPNALmRQQSYG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PHKRKRS 2) QKRRKKVGYDST | 6 264 | 12 275 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab