<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02273
Description |
Uncharacterized protein |
Sequence | MDRSQPSSSNLMDNHNRLVADILTRYRTLMMLATVQAEGERNNATPETMAVSGISIRMEFDCLNSSIKDLLSLSRKIKELWVFGPLGQDDPERKAKDAQMEEHVAMVSALLNSLDGRRMKELAERCGGSWEVLAKDAAGTTAK |
Length | 143 |
Position | Head |
Organism | Metarhizium album (strain ARSEF 1941) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.430 |
Instability index | 34.30 |
Isoelectric point | 5.73 |
Molecular weight | 15884.99 |
Publications | PubMed=25368161
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02273
No repeats found
|