<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02266
| Description |
"Mediator complex, subunit Med21/Med9" |
| Sequence | MLNNKVSSSPAPPEGHKGAGAVGRIVSPSGRADSAPLQCIWPTCTSRLENRLQVLASRQGFVVPFAIDRNPSGATMGDRLTQLQDAVDQFAQQFVACLHFVQRRHDLETLGPNDKVRDIKQEPHQREVDPLPADELAAGLKELSRDLIIKEQQIEVLISNLPGLDNSERDQERNIKDLEEKLKAAEAQRQEALKERDQILAELDSVIRSIRRP |
| Length | 213 |
| Position | Middle |
| Organism | Metarhizium album (strain ARSEF 1941) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Metarhizium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.597 |
| Instability index | 58.82 |
| Isoelectric point | 5.67 |
| Molecular weight | 23748.55 |
| Publications | PubMed=25368161
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02266
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.74| 18| 27| 117| 142| 1
---------------------------------------------------------------------------
117- 142 (22.86/30.77) RD..IKQEphQREV..DPLPadelaaGLKE
145- 166 (23.87/11.90) RDliIKEQ..QIEVliSNLP......GLDN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.03| 28| 32| 59| 87| 2
---------------------------------------------------------------------------
48- 66 (22.46/ 9.35) .........LENRL.QVLASRQGFVVPFA
67- 95 (43.78/27.56) IDRNPSGATMGDRLtQLQDAVDQFAQQFV
101- 116 (19.79/ 7.58) VQRRHDLETLGP.....NDKV........
---------------------------------------------------------------------------
|