<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02254
Description |
Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MSWNQYPWSLPDFLCNLKAWIAETTSCISVMTILLFSIERYIAICHPMLFLKLRNVRAQLPAFLVIAWLIAIAAASPYGINHRADFMLKSWPFTDDGVPVAQSKVCMVAIFFDPSLAQSFYVLIHVSFVIFFAIPLLVILVVYALIAIKNAQMAAAISSKVKKSGRSMATKALIIQEYKRRLRDNVKSLNDNFINILSAAKVRAADELLKLTHDLKEFLILHDFNFLSSAIESAEGKADKKMNEYVAKYDALRLDTASMITDIDKELNEHFSLRQ |
Length | 275 |
Position | Head |
Organism | Toxocara canis (Canine roundworm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Ascaridomorpha> Ascaridoidea> Toxocaridae> Toxocara.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.353 |
Instability index | 40.01 |
Isoelectric point | 8.94 |
Molecular weight | 31143.35 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | G protein-coupled receptor activity GO:0004930 IEA:UniProtKB-KW
transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02254
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.17| 17| 19| 110| 126| 1
---------------------------------------------------------------------------
110- 126 (31.28/18.12) IFFDPSLAQSF..YVLIHV
130- 148 (23.89/12.42) IFFAIPLLVILvvYALIAI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 93.09| 24| 24| 222| 245| 3
---------------------------------------------------------------------------
195- 218 (16.89/ 7.42) ...NILSAAkVRAADEllKLTHDLKEF
222- 245 (41.03/27.17) HDFNFLSSA.IESAEG..KADKKMNEY
249- 270 (35.17/22.37) YDALRLDTA...SMIT..DIDKELNEH
---------------------------------------------------------------------------
|