<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02247

Description Cyclin-dependent kinase 8
SequenceMNHDGIMTSKGKLQIEDVKIFRPVLGKTTMIQKWTRLMIDYQFKEELVKTRERVEDLYSFEGSKVGRGTYGHVYKAQPRHPEQIAKNGAKEFALKLIEGQGFSMSACREIALLRELKHPNLIKLQRVFLTSERKVWLLFDYAEHDLWHIIKFHRAAKQKKQPVLVPKGMVKSLLYQILDGIHYLHSNWILHRDLKPANILVMGEGPGVERGRVKIADMGFARIFHNPLKPLAELDPVVVTFWYRAPELLLGAKHYTKAIDIWAIGCIFAELLTSEPVFFCREEDIKASSPYHQDQLNRIFTVMGYPSESDWQDLKKMPEYQKLTQDFKRTKSFFVALAMMGKNNLILGITQAIDIWAIGCIFAELLTSEPVFFCREEDIKASSPYHQDQLNRIFTVMGYPSESDWQDLKKMPEYQKLTQDFKRTNYANCTLQRYMDKHKIKADTRSFSLLQRLLTMDPIKRVTAQDAMDDAYFKEDPRPTADVFSGCDIPYPKREFLSDENDDKSASASKTQQAPPPQQSQQQTIGVHPQQPIMEPAAKKMRMQQSQQMPPTQPQMDNMMNAPTGGMFAGGTATEYPAVGSGTSMNTKSSVPFEQQSHGPMMQPQHMNPQMQQMQYSQHQQHIINQQPNVYQQSQMGMGQQISGAAQTQMGPRPIQMSTQPSMMQSSYQQQMLQPGMGQQMMGAGGQTMISEQPPMGGPHPQMAPQAPMMQQMRPQMQYMDQNGRIMQQPGGMMVAQPGQEMMPPQQSQYIMQQQQQQWGPMQPRYQ
Length767
PositionKinase
OrganismToxocara canis (Canine roundworm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Ascaridomorpha> Ascaridoidea> Toxocaridae> Toxocara.
Aromaticity0.08
Grand average of hydropathy-0.618
Instability index53.01
Isoelectric point8.86
Molecular weight87955.45
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02247
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     138.54|      18|      26|     283|     300|       1
---------------------------------------------------------------------------
  283-  300 (36.83/17.66)	EDIKASSPYHQDQLNRIF
  312-  327 (31.99/14.52)	QDLKKMPEY..QKLTQDF
  377-  394 (36.83/17.66)	EDIKASSPYHQDQLNRIF
  406-  421 (32.89/15.10)	QDLKKMPEY.Q.KLTQDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     166.50|      44|      93|     247|     311|       2
---------------------------------------------------------------------------
  247-  311 (80.66/65.12)	ELLLGakhYTKAIDIWAIGCIFAELLTSEPVFFCREedikasspyhqdqlnrifTVMGYPSESDW
  344-  405 (85.85/60.42)	NLILG...ITQAIDIWAIGCIFAELLTSEPVFFCREedikasspyhqdqlnrifTVMGYPSESDW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     400.77|      95|     100|     529|     628|       3
---------------------------------------------------------------------------
  464-  551 (117.17/41.35)	AQDAM.DDAYfkedPRPTADVFS.GCD..IPYPKREFLSDENDDKSAS.........................aSKTQQAPPPQQS...qqqtigvhPQ.....QPIMEPAAKKMR.....MQQSQQM.PP
  552-  672 (154.12/65.19)	TQPQM.DNMM....NAPTGGMFAGGTA..TEYPAVGSGTSMNTKSSVPFEQ.QSHGPMMqpQHMNPqmqQMQY.SQHQQHIINQQPnvyqqsqmgmgQQisgaaQTQMGPRPIQMStqpsmMQSSYQQ.QM
  673-  761 (129.49/46.48)	LQPGMgQQMM.........G..AGGQTmiSEQP......PMGG....PHPQmAPQAPMM..QQMRP...QMQY.MDQNGRIM.QQP....ggmmvaqPG.....QEMMPPQQSQYI.....MQQQQQQwGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.78|      18|      23|      96|     115|       4
---------------------------------------------------------------------------
   96-  113 (30.78/22.40)	LIEGQGFSMSACREIALL
  121-  138 (29.99/14.72)	LIKLQRVFLTSERKVWLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.99|      11|      22|     431|     441|       7
---------------------------------------------------------------------------
  431-  441 (20.52/13.35)	LQRYMDKHKIK
  450-  460 (19.47/12.28)	LQRLLTMDPIK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02247 with CDK8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) YPKREFLSDENDDKSASASKTQQAPPPQQSQQQTIGVHPQQPIMEPAAKKMRMQQSQQMPPTQPQMDNMMNAPTGGMFAGGTATEYPAVGSGTSMNTKSSVPFEQQSHGPMMQPQHMNPQMQQMQYSQHQQHIINQQPNVYQQSQMGMGQQISGAAQTQMGPRPIQMSTQPSMMQSSYQQQMLQPGMGQQMMGAGGQTMISEQPPMGGPHPQMAPQAPMMQQMRPQMQYMDQNGRIMQQPGGMMVAQPGQEMMPPQQSQYIMQQQQQQWGPMQPRYQ
491
767










Molecular Recognition Features






MoRF SequenceStartStop




NANANA