<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02233
| Description |
Cyclin-C |
| Sequence | MAGNFWQSSHWEQWILDKQDILRMRGDDLKCITEEEYTKLMIFFCNCKLFSIVQIIHAIGMDSQLPHKTRMQVIATACVYFRRFYARRSLKDIDPFLLAPTCLFLASKVEEHGMMSHNKLIQATNNALKRWPFIQQELMIRVQHIQEAEFFLLEIMDCCLIVYHPYRPLNQLIAEMGRDHKDLDALSAHAWRICNDTTRTDLSLMYPPHQIAIACILIASIWTNRDKELRNWFAELAVDFEKILDIQKIILNLYSVWKSFDEKEQLVPILQKIPRPNPGPQNSNGGMVQSHSHNNLSMGNITMHQNVSMGPPQMPPTGSMKFEPH |
| Length | 325 |
| Position | Kinase |
| Organism | Toxocara canis (Canine roundworm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Spirurina> Ascaridomorpha> Ascaridoidea> Toxocaridae> Toxocara.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.216 |
| Instability index | 51.37 |
| Isoelectric point | 6.91 |
| Molecular weight | 37880.70 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02233
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.30| 18| 140| 66| 88| 2
---------------------------------------------------------------------------
66- 88 (29.09/34.50) PHKtrmqvIATACVYFRRFYARR
208- 225 (34.22/25.12) PHQ.....IAIACILIASIWTNR
---------------------------------------------------------------------------
|