<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02227
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MEGGEESISFVDQQFLSSRPLDEGNILEYFSGSPFYDKSCNNEILRMQTQFRGLEYNKATLSTMAGIFYEVMSVNTEKTLFIISKTYNHITHVEMLGIYYIMHGYVYSAPTNYSIYRSRMTDSMWMLNSFVIKMMEKKKFNPFSIQRKKQSTSKIEDNSNLGFMMDVFNEFRKSLEPKR |
| Length | 179 |
| Position | Head |
| Organism | Ordospora colligata OC4 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Microsporidia> Ordosporidae>
Ordospora.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.449 |
| Instability index | 55.84 |
| Isoelectric point | 7.78 |
| Molecular weight | 21058.91 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02227
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.36| 25| 29| 56| 83| 1
---------------------------------------------------------------------------
35- 67 (37.10/24.03) FYD.KSCNNEilrmQTQF.rgleYNKATLSTMAGI
68- 98 (38.26/32.95) FYEvMSVNTE....KTLFiisktYNHITHVEMLGI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.15| 25| 29| 123| 149| 2
---------------------------------------------------------------------------
123- 149 (43.35/27.21) SMWMLNSFVIKMMEkkKFNPF..SIQRKK
153- 179 (39.81/19.92) SKIEDNSNLGFMMD..VFNEFrkSLEPKR
---------------------------------------------------------------------------
|