<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02220
| Description |
Mediator of RNA polymerase II transcription subunit 30 isoform A |
| Sequence | MEEQQSKTTQELAMEGQKYLEETIENAFQILSSMNDELCNPVLWSTSPSASSSPNADATSENSNHHADATTAAAGGGGALEQARSRYKKAVAALRTILTAIPNSQKANAFNASSAASPADEAEIDKLEERASSLRRELANKNLHLKTLIDQLRDLITDISTWHSPFST |
| Length | 168 |
| Position | Head |
| Organism | Glycine soja (Wild soybean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.581 |
| Instability index | 63.46 |
| Isoelectric point | 4.97 |
| Molecular weight | 18161.75 |
| Publications | PubMed=25004933
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02220
No repeats found
|