<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02218

Description U-box domain-containing protein 35
SequenceMDKILEADANNMSQHSSSSVVALAIKGNKKSKYVVQWALNKFVPEGMIIFKLIHVHGGIKGVPTPLGNVIPLSQVRNDVATAFKKEVEWQTNQMLLPFKRMCEQRKVHVDVIVIESDDVATAIADEVAKGAITKLVVGASSRGLFKSKQKGMSTRISVSTPRFCTIYAISKGKLSIRPSDMPIDGNIIDDASESETSLSTSSSSNYTSTSQTESASVSSYAALQSSSLTTQRFQALSSINSALLSTNPSFADTNHSRGQSLDLGRENTASSSARNSDIDHALSRVSSCKSFISDTESWMYDQNSSKDVQLATTLPSPNRQAKYNLELEKLRIELRHAQGLHAVAQTEKIEASRKLNDLSKRRSEETMRMKEIISKEEKAKELAKLEREKYQDASREAEYLKECAEREAAEKKEMELRAIRAAKEKEKLEDALSGSTPQYRKFTWDEIILATSSFSEDLKIGMGAYGVVYKCNLYHTTVAVKVLTLNTNVNSKRKQFQQELEILSRIRHPNLLLLLGACPDHGCLVYEYMENGNLEDRLLRKNNTSPIPWFERFRIALEVASSLAFLHSSKPEPIIHRDLKPANILLDRNLVSKIGDIGLSTVLNSDNLSIMSKDTAPVGTLCYIDPEYQRTGLISPKSDIYAFGMVILQLLTAKPAIALAHKVETAIDSGNLTDILDPEAGAWPYQETLDLALLGLSCAELRRRDRPDLQDHVLPTLERLKEVVDRAQCSASIVTIKSKPPNHFICPILQDVMDDPCVAADGYTYDRKAIEKWLEENDKSPMTNMALPHKHLIPNYTLLSAILEWKSRES
Length810
PositionTail
OrganismGlycine soja (Wild soybean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine> Glycine subgen. Soja.
Aromaticity0.06
Grand average of hydropathy-0.366
Instability index42.77
Isoelectric point7.02
Molecular weight90236.87
Publications
PubMed=25004933

Function

Annotated function Functions as an E3 ubiquitin ligase. 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02218
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.89|      23|      28|     347|     371|       1
---------------------------------------------------------------------------
  347-  371 (31.78/26.12)	EkiEASRKLNDLSKRRSEETMRMKE
  376-  398 (35.10/22.16)	E..EKAKELAKLEREKYQDASREAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     230.73|      65|     319|     231|     295|       2
---------------------------------------------------------------------------
  162-  227 (90.26/66.08)	.RFCTIYAISKGKLSIRPSdmPIDGNIIDDASESETSLSTSSSSNYTSTSQTESASVSSYAALQSSS
  231-  295 (106.30/79.42)	QRFQALSSINSALLSTNPS..FADTNHSRGQSLDLGRENTASSSARNSDIDHALSRVSSCKSFISDT
  298-  329 (34.17/19.45)	WMYDQNSSKDVQLATTLPS.....PNRQAKYNLELEK..............................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.76|      21|      51|      35|      55|       4
---------------------------------------------------------------------------
   35-   55 (38.10/28.09)	VQWALNK.FVP.EGMIIFKLIHV
   87-  109 (30.67/21.21)	VEWQTNQmLLPfKRMCEQRKVHV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.56|      17|      39|      68|      86|       5
---------------------------------------------------------------------------
   68-   86 (24.69/20.77)	NVIPLSQvrNDVATAFKKE
  110-  126 (27.87/16.63)	DVIVIES..DDVATAIADE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02218 with Med32 domain of Kingdom Viridiplantae
Unable to open file!