<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02207
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MPIRCILHWQPNQGSVVNSQVLNEISQCVESLNGVKEGRCKASLTFYRPNLRDQSVTIDFPRDFLGISMLEQPNKYYLIIRGQKIVLEADSSILLIMEKLQSYKSKVALHFEGVLYKLGDFQIRVIKVVPSQAESLRGIMIEIEYLPISSVEKSKQILEEFIDIWKEVVSKKSLAGQFMHTEPNYAEYGLSDNYTSQHTAVQYAAALAQLIQSAQLRN |
Length | 218 |
Position | Head |
Organism | Glycine soja (Wild soybean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Glycine>
Glycine subgen. Soja.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.131 |
Instability index | 46.86 |
Isoelectric point | 6.91 |
Molecular weight | 24829.37 |
Publications | PubMed=25004933
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02207
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.22| 18| 40| 80| 97| 1
---------------------------------------------------------------------------
80- 97 (29.15/21.18) IRGQKIVLEADSSILLIM
123- 140 (30.07/22.05) IRVIKVVPSQAESLRGIM
---------------------------------------------------------------------------
|