Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEGSHRRNLPGGYLTPSPGSQDPDSPIPPFVNQGPGYDELVSESDGDADHIFTNNITTTMEEQDGASLSSTFPNPPPFWRDFTADKVARYEQLRNEYDEGEAERTATDENYKPQSRIPNLPEELMHLQPPEEPADGRWRVFGDQYMLDDQLPTLEEQGITNLPASGQSSARDAKHYDRAFELKRLAKSLLLNFLELTGALSRSPWHAEAKVQDLRTLFINVHHILNEYRPHQARESAIEMMQDHLDRTRTETLAIRTQVDKARRLLEGLGSLGLGGDTAGAGAGVAGAGAQQTAEKEMKSDGDAAAAAAAAAAAAKGVDVDWERERQIWASVDDLFS |
Length | 337 |
Position | Middle |
Organism | Beauveria bassiana D1-5 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Cordycipitaceae> Beauveria. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.719 |
Instability index | 54.11 |
Isoelectric point | 4.71 |
Molecular weight | 37138.40 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02192 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 137.86| 44| 57| 1| 55| 1 --------------------------------------------------------------------------- 1- 55 (68.77/53.11) MEGSHRRNLPGGYltpspgsqdPDsPiPPF.....VNQGPGYDELVSESD.GDADHIFTNN 60- 109 (69.09/32.41) MEEQDGASLSSTF.........PN.P.PPFwrdftADKVARYEQLRNEYDeGEAERTATDE --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) MEGSHRRNLPGGYLTPSPGSQDPDSPIPPFVNQGPGYDELVSESDGDADHIFTNNITTTMEEQDGASLSSTFPNPPPFWRD 2) RYEQLRNEYDEGEAERTATDENYKPQSRIPNLPEELMHLQPPEEP | 1 89 | 81 133 |
MoRF Sequence | Start | Stop |
NA | NA | NA |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab