<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02189

Description Glucose-6-phosphate 1-dehydrogenase
SequenceMSQTSPYALSQGPSPTIELSLPLTTPSAMELKENTTIVVLGASGDLAKKKTYPALFGLYRNQFLPKDVRIVGYARTKMDHEEYLRRIKSYIKTPTKEIEQQLEDFTKVCSYVSGQYDKDESFEGLTKHLEELEKGRSEHNRLFYMALPPSVFTIVSQHLKKCCYPTNGIARVIVEKPFGKDLASSRELQKSLEPDWKEEELYRIDHYLGKEMVKNILIMRFGNSFLGATWNRHHIDNVQITFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQVLTLLAMERPVSFDSEDIRDEKVRVLRAIPTLEPKNVIIGQYGRSLDGSKPAYKEDDTVPQDSRCPTFCALVAYIKNERWDGVPFIMKAGKALNEQKTEIRIQFKDVTSGIFKDIPRNELVMRIQPNESVYIKMNSKLPGLSMQTVVTELDLTYRRRFSDLKIPEAYESLVLDCLKGDHSNFVRDDELDASWRIFTPLLHYLDDNKEIIPMEYPYGSRGPAVLDDFTASYGYKFSDAAGYQWPTTSAVPSNNNSSSSSNKFNVKDVVDQRAAPDHKGKAKASGNPSDPPRMNDLPDEITHITQGFIPLSAFLTRLAQVTHNSLQEKVAELSKMPIPASALNGGATNLTSSAPDDTSAENLRKKATLLHFAQDMHAKWVKALVITEWSRRANMVSKLIDLKFHMDQLRVHYDVCLDNMVNVKRDLTYARMPAPDLKTALQVLSTGSAPWIPDSQHQYIEPPPLTADEKLRWIKDLNTRLSLRLNLQDYDKIPHQFRNYEIGSGRVTFKVPDEFEVELTIADEDTDKQFWFIDFRYTFRPSALSLSEGLRNYLENYVNDALARNGLAGCYQFLHEMVLTAKLTELKRQALRLSRTSWDGTLVVEPLNRALAIQYWSSRSTTTKSWVLIAINSGKKNGKVDKKSPSYLVAKWYRDNKEVKDVKLTLDVGTLSAESLLKEVIGRHIGYILQNIRDKLLEAPRFKQHEAAMNLRISNTNPGDCMLTTQVSHNATTTLLVEPTTGIFAVKPQSKFSIPYEHQLNSGKNSTDDGAACLENVRCAMMEDELHRRGNTMGWQTQKMPLSVEEVKSVTKMRDWTRTIWMRKQGWGESWYMAIFLGLGGDEWWLLEANRNEPGRTVKFQARLPLSKGHPDFATAFWGNLAIFATGMIAQAVDMRELHRLRIKSRTNDSINLALPQQLQLPSIQVALSAMFPSIVHNGGSKSEYRQPWANDVVTIRFTGIESTDDSLMCLSEAVLRVRKPSKFAALKGTVDGNLLYNAKLGEFCLRVQHAVGEPVLALLKSRIKAIDRFVNFLEAMDKSKGSIVGELVTLKEIRFLYYQAGSESKQQWRITLDLSKNDIAIKIERGNPHLRVVDLMQQLVNSDGGIGALMRWLPASLRALEAVSSIETRWEDMQLKRLGRVDFAMKTLSWLSLQYTMTVADPSPTNRVILLQVRTQTRRGEAWWHVWRSHDGIAPSESDDDDAYAAALRSVWNGRGPGWIGLSTGAAARCESGVVGMLLAVDDAVRSVVVDDSSTAVPTQSSTNPSFTQRTSQSLNSGKDVVVLE
Length1554
PositionTail
OrganismBeauveria bassiana D1-5
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Cordycipitaceae> Beauveria.
Aromaticity0.08
Grand average of hydropathy-0.390
Instability index39.96
Isoelectric point8.38
Molecular weight175699.52
Publications









Function






Annotated function

Catalyzes the rate-limiting step of the oxidative pentose-
phosphate pathway, which represents a route for the dissimilation of
carbohydrates besides glycolysis. 

Catalyzes the rate-limiting step of the oxidative pentose-
phosphate pathway, which represents a route for the dissimilation of
carbohydrates besides glycolysis. The main function of this enzyme is
to provide reducing power (NADPH) and pentose phosphates for fatty acid
and nucleic acid synthesis. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
glucose-6-phosphate dehydrogenase activity	GO:0004345	IEA:UniProtKB-EC
NADP binding	GO:0050661	IEA:InterPro
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
glucose metabolic process	GO:0006006	IEA:UniProtKB-KW
pentose-phosphate shunt, oxidative branch	GO:0009051	IEA:EnsemblFungi
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro
response to hydrogen peroxide	GO:0042542	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02189
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.14|      21|     513|    1013|    1033|       1
---------------------------------------------------------------------------
 1013- 1033 (39.29/22.80)	AVKPQS....KFSIPYEHQLNSGKN
 1525- 1549 (31.85/17.22)	AVPTQSstnpSFTQRTSQSLNSGKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.89|      39|     222|     813|     866|       4
---------------------------------------------------------------------------
  123-  161 (67.50/33.79)	EGLTKHLEELEKGRSEHNRL..FYMALPPSVFTIVSQHLKK
  816-  856 (62.39/52.25)	EGLRNYLENYVNDALARNGLagCYQFLHEMVLTAKLTELKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.78|      11|     222|     650|     660|       5
---------------------------------------------------------------------------
  650-  660 (20.47/13.15)	KALVITEWSRR
  877-  887 (21.32/14.03)	RALAIQYWSSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     131.79|      43|     113|      52|      98|      12
---------------------------------------------------------------------------
   52-   98 (67.27/56.75)	YPAlFGLYR...NQFLPKDVRIVGYARTKMD...HEEYLRRIKSYIktpTKEI
  164-  212 (64.52/41.61)	YPT.NGIARvivEKPFGKDLASSRELQKSLEpdwKEEELYRIDHYL...GKEM
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02189 with Med14 domain of Kingdom Fungi
Unable to open file!