<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02184
| Description |
Uncharacterized protein |
| Sequence | MAPVTLNGIDKDIKDVIQHLFEIQSAVHGYLGAETQQELVRKM |
| Length | 43 |
| Position | Middle |
| Organism | Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) (Paracoccidioides brasiliensis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Paracoccidioides.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.126 |
| Instability index | 33.33 |
| Isoelectric point | 5.40 |
| Molecular weight | 4837.53 |
| Publications | PubMed=22046142
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02184
No repeats found
No repeats found
|